PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32198.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 500aa    MW: 56421.5 Da    PI: 5.7411
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32198.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-17221267148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT +Ed  l+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
  mrna32198.1-v1.0-hybrid 221 KGQWTIDEDRVLIQLVEQYGVRKWSHIAQMLP-GRIGKQCRERWHNHL 267
                              799*****************************.*************97 PP

2Myb_DNA-binding56.75.6e-18275315345
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                               W++eEd++l++a+++ G++ W+ Ia++++ gRt++++k++w+
  mrna32198.1-v1.0-hybrid 275 IWSEEEDKILIQAHAEIGNK-WAEIAKRLP-GRTENSIKNHWN 315
                              6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.072216271IPR017930Myb domain
SuperFamilySSF466891.26E-31218314IPR009057Homeodomain-like
SMARTSM007172.0E-15220269IPR001005SANT/Myb domain
PfamPF002493.7E-16221267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-27222273IPR009057Homeodomain-like
CDDcd001674.01E-15224267No hitNo description
SMARTSM007174.7E-17272320IPR001005SANT/Myb domain
PROSITE profilePS5129421.072272322IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-22274321IPR009057Homeodomain-like
PfamPF002491.1E-16276315IPR001005SANT/Myb domain
CDDcd001673.54E-14276318No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MELNKLRDNL ASQIPLLVPE NNNSYMMKPY NMKEEFIPFE PSSSSKGYLQ DFHHLDNQFH  60
QYASGSSSNP MLGIQNPCFE PYYNENNNAC YTYDQGSPAD VNFYECKPLI ISENLGHGQV  120
LDNFQSGSSG GGYLNFPNPR SNPIGHMMGI SHRSGTNFLP LTNSQDIKPV SFVVPDEDSC  180
VNSENGYYKR VGMNHKGTSR LSTISRAGST FKGRKKNNVV KGQWTIDEDR VLIQLVEQYG  240
VRKWSHIAQM LPGRIGKQCR ERWHNHLRPD IKKDIWSEEE DKILIQAHAE IGNKWAEIAK  300
RLPGRTENSI KNHWNATKRR QYSKRKCRSR YPRGSLLQDY IKSLNLDAAP NTGRQRKSNN  360
NNSNSSPADH SNATTDSTKV QSQTNVGFNS ENDRLVPNYE FSEEEADFCF DENMFEEGCS  420
IDSLLDDISC ATDFGQNGNG FGKMMGSSAH DPVPVDDEKN VEMLDVHVNL GSTVIESNEV  480
KQELDLVEMM TQVNEADDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-452193212104C-Myb DNA-Binding Domain
1msf_C2e-452193212104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239795.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L21e-109MYB98_ARATH; Transcription factor MYB98
TrEMBLM5WSR40.0M5WSR4_PRUPE; Uncharacterized protein
STRINGGLYMA05G02300.21e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-106myb domain protein 98